>4i93_A mol:protein length:300  Probable serine/threonine-protein kinase At5g41260
MAHHHHHHSSGQFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVK
RFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFH
WESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKN
SRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRN
IQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQ
LLGVP
>4i93_B mol:protein length:300  Probable serine/threonine-protein kinase At5g41260
MAHHHHHHSSGQFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVK
RFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFH
WESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKN
SRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRN
IQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQ
LLGVP
>4i93_B mol:protein length:300  Probable serine/threonine-protein kinase At5g41260
MAHHHHHHSSGQFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVK
RFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFH
WESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKN
SRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRN
IQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQ
LLGVP