>4ia8_A mol:protein length:82  Regulatory protein
GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTAISGIERNSRNLTIKSLELI
MKGLEVSDVVFFEMLIKEILKHD