>4iqj_A mol:protein length:1220  DNA polymerase III subunit alpha
MGSKLKFAHLHQHTQFSLLDGAAKLQDLLKWVKETTPEDPALAMTDHGNLFGAVEFYKK
ATAMGVKPIIGYEAYVAAESRFDRKRGKGLDGGYFHLTLLAKDFTGYQNLVRLASRAYL
EGFYEKPRIDREILREHAQGLIALSGCLGAEIPQFILQDRLDLAEARLNEDLSIFGDRF
FIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNDGHYVRKEDARAHEVLLAIQSKTTL
DDPERWRFPCDEFYVKTPEEMRAMLPEAEWGDEPFDNTVEIARMCDVDLPIGDKMVYRI
PRFPLPEGRTEAQYLRELTFLGLLRRYPDRITEAFYREVLRLLGTMPPHGDERALAEAL
ARVEEKAWEELRKRLPPLEGVREWTAEAILHRALYELSVIERMGFPGYFLIVQDYINWA
RGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRE
RDRVIQYVRERYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGK
PKPLQEAIQVVPELRAEMEKDERIRQVIEVAMRLEGLNRHASVHAAGVVIAAEPLTDLV
PLMRDQEGRPVTQYDMGAVEALGLLKMDFLGLRTLTFLDEARRIVKESKGVELDYDRLP
LDDPKTFELLSRGETKGVFQLESGGMTATVRGLKPRRLEDIIALVSLYRPGPMEHIPTY
IRRHHGQEPVSYAEFPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYSLGEADLLRR
AMGKKRVEEMQKHRERFVRGAKERGVPEEEANRLFDMLEAFANYGFNKSHAAAYSLLSY
QTAYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDFKVVGE
EILFGLSAVKNVGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNKRALESLVKAGAL
DAFGDRARLLASLEPLLRWAAETRERGRSGLVGLFAEVEEPPLVEASPLDEITMLRYEK
EALGIYVSGHPVLRYPGLREVASCTIEELSEFVRELPGKPKVLLSGMVEEVVRKPTRSG
GMMARFTLSDETGALEVVVFGRAYEGVSPKLKEDIPLLVLAEVEKGEELRVLAQAVWTL
EEVLEAPKALEVEVDHALLDEKGVARLKSLLDEHPGSLPVYLRVLGPFGEALFALREVR
VGEEALGLLEAEGYRAYLVPDREVFLQGNGGGPKEEVVPF