>4iqj_P mol:protein length:177  DNA polymerase III subunit gamma/tau
HHHHHHKAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHKK
AEEQKAHLLPLARAQFGVEELAFVLEKKSLSGASPPPPTKPVPPREAPPPVAAPPPEPE
PPLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEAEEPVSEDGIGGNGIMPP