>4ive_A mol:protein length:98  Polyadenylate-binding protein 3
GQGQETLTASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYML
ESPESLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPTV