>4ive_B mol:protein length:98  Polyadenylate-binding protein 3
GQGQETLTASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYML
ESPESLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPTV