>4ive_D mol:protein length:98  Polyadenylate-binding protein 3
GQGQETLTASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYML
ESPESLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPTV