>4iym_O mol:protein length:521  Methylmalonate-semialdehyde dehydrogenase
MHHHHHHSSGVDLGTENLYFQSMMYELGHFIDGKRVAGTSGRVSNIFNPATGEVQGTVA
LASDADLAAAVESAKAAQPKWAATNPQRRARVFMKFVQLLNDNMNELAEMLSREHGKTI
DDAKGDIVRGLEVCEFVIGIPHLQKSEFTEGAGPGIDMYSIRQPVGIGAGITPFNFPGM
IPMWMFAPAIACGNAFILKPSERDPSVPIRLAELMIEAGLPAGILNVVNGDKGAVDAIL
THPDIAAVSFVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAANALIGA
GYGSAGERCMAISVAVPVGEETANRLIDKLVPMVESLRIGPYTDEKADMGPVVTKEAEQ
RIRSLIDSGIEQGAKLVVDGRDFKLQGYENGHFIGGCLFDDVTPDMDIYKTEIFGPVLS
VVRARNYEEALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMVGVNVPIPVPLAYHS
FGGWKSSSFGDLNQHGTDSIKFWTRTKTITSRWPSGIKDGAEFSIPTMR