>4j1o_A mol:protein length:391  Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
MHHHHHHSSGVDLGTENLYFQSMKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKI
VADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCG
HNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVA
EGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEI
PFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGL
QQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYD
EENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
>4j1o_B mol:protein length:391  Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
MHHHHHHSSGVDLGTENLYFQSMKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKI
VADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCG
HNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVA
EGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEI
PFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGL
QQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYD
EENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
>4j1o_B mol:protein length:391  Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
MHHHHHHSSGVDLGTENLYFQSMKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKI
VADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCG
HNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVA
EGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEI
PFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGL
QQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYD
EENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS