>4jdl_B mol:protein length:223  Abscisic acid receptor PYL5
MGSSHHHHHSSGENLYFQGHMRSPVQLQHGSDATNGFHTLQPHDQTDGPIKRVCLTRGM
HVPEHVAMHHTHDVGPDQCCSSVVQMIHAPPESVWALVRRFDNPKVYKNFIRQCRIVQG
DGLHVGDLREVMVVSGLPAVSSTERLEILDEERHVISFSVVGGDHRLKNYRSVTTLHAS
DDEGTVVVESYIVDVPPGNTEEETLSFVDTIVRCNLQSLARSTNRQ