>4k4i_P mol:na length:4  DNA (5'-D(P*GP*CP*CP*G)-3')
GCCG
>4k4i_G mol:na length:6  DNA (5'-D(*CP*AP*GP*TP*AP*C)-3')
CAGTAC
>4k4i_F mol:na length:11  DNA (5'-D(*CP*GP*GP*CP*GP*GP*TP*AP*CP*TP*G)-3')
CGGCGGTACTG
>4k4i_B mol:na length:11  DNA (5'-D(*CP*GP*GP*CP*GP*GP*TP*AP*CP*TP*G)-3')
CGGCGGTACTG
>4k4i_H mol:na length:4  DNA (5'-D(P*GP*CP*CP*G)-3')
GCCG
>4k4i_A mol:protein length:340  DNA polymerase lambda
MSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSI
PGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLE
DIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRL
PGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVR
NTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDWLEHHHHHH
>4k4i_I mol:protein length:340  DNA polymerase lambda
MSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSI
PGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLE
DIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRL
PGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVR
NTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDWLEHHHHHH
>4k4i_L mol:na length:4  DNA (5'-D(P*GP*CP*CP*G)-3')
GCCG
>4k4i_M mol:protein length:340  DNA polymerase lambda
MSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSI
PGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLE
DIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRL
PGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVR
NTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDWLEHHHHHH
>4k4i_J mol:na length:11  DNA (5'-D(*CP*GP*GP*CP*GP*GP*TP*AP*CP*TP*G)-3')
CGGCGGTACTG
>4k4i_D mol:na length:4  DNA (5'-D(P*GP*CP*CP*G)-3')
GCCG
>4k4i_E mol:protein length:340  DNA polymerase lambda
MSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSI
PGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLE
DIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRL
PGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVR
NTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDWLEHHHHHH
>4k4i_N mol:na length:11  DNA (5'-D(*CP*GP*GP*CP*GP*GP*TP*AP*CP*TP*G)-3')
CGGCGGTACTG
>4k4i_P mol:na length:4  DNA (5'-D(P*GP*CP*CP*G)-3')
GCCG
>4k4i_C mol:na length:6  DNA (5'-D(*CP*AP*GP*TP*AP*C)-3')
CAGTAC
>4k4i_K mol:na length:6  DNA (5'-D(*CP*AP*GP*TP*AP*C)-3')
CAGTAC
>4k4i_O mol:na length:6  DNA (5'-D(*CP*AP*GP*TP*AP*C)-3')
CAGTAC