>4kal_A mol:protein length:352  Probable sugar kinase protein
MHHHHHHSSGVDLGTENLYFQSMTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNL
IDAERAELLYSRMGPALEASGGSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRA
QGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVEADVVADAKVTYF
EGYLWDPPRAKEAILDCARIAHQHGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFA
NRQEALSLYQTDDFEEALNRIAADCKIAAVTMSENGAVILKGRERYYVNAIRIREVVDT
TGAGDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSLSEAAKQAGLI