>4keu_C mol:protein length:314  Aryldialkylphosphatase
MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQF
GVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLF
IHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNT
GLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRN
ETTLRLIKDGYSDKIMISHDYCCTIDMGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNG
VNEEVIATIFKENPKKFFS
>4keu_B mol:protein length:314  Aryldialkylphosphatase
MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQF
GVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLF
IHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNT
GLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRN
ETTLRLIKDGYSDKIMISHDYCCTIDMGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNG
VNEEVIATIFKENPKKFFS
>4keu_D mol:protein length:314  Aryldialkylphosphatase
MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQF
GVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLF
IHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNT
GLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRN
ETTLRLIKDGYSDKIMISHDYCCTIDMGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNG
VNEEVIATIFKENPKKFFS
>4keu_A mol:protein length:314  Aryldialkylphosphatase
MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQF
GVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLF
IHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNT
GLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRN
ETTLRLIKDGYSDKIMISHDYCCTIDMGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNG
VNEEVIATIFKENPKKFFS
>4keu_D mol:protein length:314  Aryldialkylphosphatase
MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQF
GVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLF
IHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNT
GLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRN
ETTLRLIKDGYSDKIMISHDYCCTIDMGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNG
VNEEVIATIFKENPKKFFS