>4lf5_G mol:protein length:156  ribosomal protein S7
MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPL
KVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAV
RIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW