>4lf5_P mol:protein length:88  ribosomal protein S16
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYW
LSVGAQPTDTARRLLRQAGVFRQEAREGA