>4lgd_H mol:protein length:49  Ras association domain family member 5, RASSF5
GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
>4lgd_A mol:protein length:378  Serine/threonine-protein kinase 3
MHHHHHHGSSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV
PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMA
KRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPT
NPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEA
MEIKAKRHEEQQRELEEEENWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELR
QRYTAKRQPILDAMDAKKRRQQNF
>4lgd_D mol:protein length:378  Serine/threonine-protein kinase 3
MHHHHHHGSSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV
PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMA
KRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPT
NPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEA
MEIKAKRHEEQQRELEEEENWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELR
QRYTAKRQPILDAMDAKKRRQQNF
>4lgd_F mol:protein length:49  Ras association domain family member 5, RASSF5
GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
>4lgd_B mol:protein length:378  Serine/threonine-protein kinase 3
MHHHHHHGSSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV
PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMA
KRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPT
NPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEA
MEIKAKRHEEQQRELEEEENWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELR
QRYTAKRQPILDAMDAKKRRQQNF
>4lgd_E mol:protein length:49  Ras association domain family member 5, RASSF5
GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
>4lgd_H mol:protein length:49  Ras association domain family member 5, RASSF5
GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
>4lgd_G mol:protein length:49  Ras association domain family member 5, RASSF5
GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
>4lgd_C mol:protein length:378  Serine/threonine-protein kinase 3
MHHHHHHGSSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV
PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMA
KRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPT
NPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEA
MEIKAKRHEEQQRELEEEENWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELR
QRYTAKRQPILDAMDAKKRRQQNF