>4lgd_D mol:protein length:378  Serine/threonine-protein kinase 3
MHHHHHHGSSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQV
PVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMA
KRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPT
NPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEA
MEIKAKRHEEQQRELEEEENWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELR
QRYTAKRQPILDAMDAKKRRQQNF