>4lgd_H mol:protein length:49  Ras association domain family member 5, RASSF5
GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES