>4ll4_B mol:protein length:105  Thioredoxin
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDV
DDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV