>4ll7_E mol:protein length:96  SWI5-dependent HO expression protein 3
SSRVIESLHDQIDMLTKTNLQLTTQSQNLLSKLELAQSKESKLLENLNLLKNENENLNS
IFERKNKKLKELEKDYSELSNRYNEQKEKMDQLSKLA