>4lox_A mol:protein length:302  LAGLIDADG homing endonuclease I-SmaMI
SKGENGKLNPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVAIFSVTVDKKDLFLLESLK
TFFGGLGSIKKSGNSTFSYRIESSEQLTKIILPFFDKYSLITEKLGDYLLFKKVLELMG
TKEHLTQRGLEKIVSLKASINKGLSEELQAAFPQCVPTPRPEINNKLIPDPFWLAGFVS
GDGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSRGPWLY
YTVTNFSDIQGKIIPFFHQYKIIGSKYGDYMDWCKIALIMQNKNHLTPEGLNEIRALKG
GMNKGRL
>4lox_C mol:na length:11  DNA (5'-D(P*TP*GP*GP*AP*GP*GP*AP*TP*AP*CP*C)-3')
TGGAGGATACC
>4lox_E mol:na length:10  DNA (5'-D(P*CP*AP*GP*GP*TP*GP*TP*AP*CP*G)-3')
CAGGTGTACG
>4lox_E mol:na length:10  DNA (5'-D(P*CP*AP*GP*GP*TP*GP*TP*AP*CP*G)-3')
CAGGTGTACG
>4lox_D mol:na length:15  DNA (5'-D(*GP*GP*TP*AP*TP*CP*CP*TP*CP*CP*AP*TP*TP*AP*T)-3')
GGTATCCTCCATTAT
>4lox_B mol:na length:14  DNA (5'-D(*CP*GP*TP*AP*CP*AP*CP*CP*TP*GP*AP*TP*AP*A)-3')
CGTACACCTGATAA