>4m04_D mol:na length:4  downstream primer strand
GCCG
>4m04_T mol:na length:9  template strand
CGGCATACG
>4m04_P mol:na length:4  upstream primer strand
CGTA
>4m04_A mol:protein length:356  DNA-directed DNA/RNA polymerase mu
GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASV
LKALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIF
GVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRSDVDALQQVVE
EAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILY
HQHQHSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLG
WTGSKLFQRELRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQR
NA
>4m04_D mol:na length:4  downstream primer strand
GCCG