>4mca_B mol:protein length:367  Glycerol dehydrogenase
MLRIIQSPGKYIQGANALAAVGQYAKSLADHYLVIADDFVMKLAGDTLMGSLQQHGVKH
HAALFNGECCHKEIDRLGRELKAHGCRGVIGVGGGKTLDTAKAIAHYQQLPVVLIPTIA
STDAPTSALSVIYTEQGEFAEYLIYPRNPDMVVMDVAIIAKAPVRLLVAGMGDALSTYF
EAQACFDAQATSMAGGKSTLAALSLARLCYDTLLAEGVKAKLAVEAGVVTEAVERIIEA
NTYLSGIGFESSGLAAAHAIHNGFTVLEECHHLYHGEKVAFGTLAQLVLQNSPMAQIET
VLAFCHRIGLPITLAEMGVSGDAVEKIMAVAQASCAAGETIHNMPFKVTPAGVQAAILT
ADRLGSAWLQQHQ