>4mt5_B mol:protein length:184  Mucus binding proteinn
MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKF
GVGTPTYEVHFKHGMTHTDATDKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYT
TDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQINEFTVTPDSKDIVKT
VVYVGDP
>4mt5_B mol:protein length:184  Mucus binding proteinn
MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKF
GVGTPTYEVHFKHGMTHTDATDKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYT
TDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQINEFTVTPDSKDIVKT
VVYVGDP
>4mt5_A mol:protein length:184  Mucus binding proteinn
MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKF
GVGTPTYEVHFKHGMTHTDATDKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYT
TDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQINEFTVTPDSKDIVKT
VVYVGDP