>4n9n_B mol:protein length:438  Sterol uptake control protein 2, Lysozyme
GSHMDLSTKGNLNLIDMKLFHHYCTKVWPTITAAKVSGPEIWRDYIPELAFDYPFLMHA
LLAFSATHLSRTETGLEQYVSSHRLDALRLLREAVLEISENNTDALVASALILIMDSLA
NASVDNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTN
GVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGF
TNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYVDSMSPSAWIFH
VKGAATILTAVWPLSERSKFHNIISVDLSDLGDVINPDVGTITELVCFDESIADLYPVG
LDSPYLITLAYLDKLHREKNQGDFILRVFTFPALLDKTFLALLMTGDLGAMRIMRSYYK
LLRGFATEVKDKVWFLEGVTQVLPQ