>4o65_A mol:protein length:166  Putative archaeal ammonia monooxygenase subunit B
HGVQAQLQSRFVKIEDETFSATRLITKAEFAKRTFGNSDLETLKQVDAMGCDPARRQDV
LIVTGRLVSQVKQDLNAWISLFTEASNAGNRWEFISRDPPGNVFTIPGGGEVPYKLCLS
ALEPGTYHAHTQLNIASVGPGLGPGMSIVVEGEPTEKPSAWSHPQFEK