>4o8m_G mol:protein length:346  TRAP dicarboxylate transporter, DctP subunit
MKLLSKSIKAILSVGLLGLAINAQAETEIMVAYGNQPGEPIDKAMHFWADKVKEKSNGD
IVFKLFPSSQLGSETEVLEQAKFGANIITISDYGALMDIVPDLGVINAPYISQSFEKKS
KLLHSDWFKDLSDKLDQHDIHIIVPDVIYGTRHLLTKKPVTKPSDLKGMKVRVQHSRLF
LQTINAMGGVPTPMSLSDVYPGLSEGIIDGLENPTVVLFGGKFFEVAKNLNLTAHTKHM
SPFVAGTAFWNNLTPEQQKIIVDASREMVTYGGGLIEQAENEALENLKKAGVTVNDVDL
PAFEASVADVISTGFPEWSPNLYKNVQEKLSQFAENLYFQGHHHHHHHHHH