>4o9u_F mol:protein length:384  NAD/NADP transhydrogenase alpha subunit 1
MHHHHHHHHMVTVAVPKERAPGERRVALVPEVVARLVKGGARVRVERGAGEGAYHPDEA
YQEAGAEVVERGELLKGAHLLFTVQPPPEDLIQALEPGAIVVGFVQPHKNLELVRALQA
KKATVIAMELIPRITRAQSMDALSSQATVAGYLAAIHAARLSPRFFPMLTTAAGTIRPA
KVMVMGVGVAGLMAIATAKRLGAQVFAYDVRKAALEQALSLGAKPIELPISAEGEGGYA
RELTEEEKRIQHEALRDHVAGMDVLITTAQVPGRRAPILLTEDMVERLKPGTVVVDLAA
ESGGNCVLTKPGEVVEVRGVRVYGPLNLPSELSVHASEMYAKNLYNLSSLLIEKGAFAP
KWEDEIVRAALLMKEGEVLHGPTKALLGGA
>4o9u_A mol:protein length:100  NAD(P) transhydrogenase subunit alpha 2
MEFGFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVVVVGAMVVLGHAETG
LEKLIGFLGVILGAANAAGGYAVTVRMLEMFERKPGQGGGR
>4o9u_B mol:protein length:450  NAD(P) transhydrogenase subunit beta
MDLIQAAYFVVAILFIVGLKRMAHPTTAKSGIVWAGWGMVLAVLATFFWPGMGNFALIL
LALLLGSVVAWWAAVRVAMTDMPQMVAIYNGMGGGAAATIAAVELLKGAFENTGLMALA
ILGGLIGSVAFTGSLIAFAKLQGIMKSRPILFPGQKAVNALVLALTVVIGLSLLWNDAT
ASIVLFFLLALLFGVLMTLPIGGGDMPVAISFYNAFTGMAVGFEGFAVGNPALMVAGTL
VGAAGTLLTVLMARAMNRSVWSVLVGGFGVEQEAGEVKGSLKPIDVEDAAVMLAYAGKV
VFVPGYGMALSQAQHKLKELADLLEARGVEVKFAIHPVAGRMPGHMNVLLAEAGVDYDK
LKDLEEINPEFPTVDVAVVIGANDVVNPAARRPGSPLYGMPILDVDKAKNVIVIKRGQG
KGFAGVENELFYAENTRMLYGDAQKVLTELIQALKRL
>4o9u_D mol:protein length:450  NAD(P) transhydrogenase subunit beta
MDLIQAAYFVVAILFIVGLKRMAHPTTAKSGIVWAGWGMVLAVLATFFWPGMGNFALIL
LALLLGSVVAWWAAVRVAMTDMPQMVAIYNGMGGGAAATIAAVELLKGAFENTGLMALA
ILGGLIGSVAFTGSLIAFAKLQGIMKSRPILFPGQKAVNALVLALTVVIGLSLLWNDAT
ASIVLFFLLALLFGVLMTLPIGGGDMPVAISFYNAFTGMAVGFEGFAVGNPALMVAGTL
VGAAGTLLTVLMARAMNRSVWSVLVGGFGVEQEAGEVKGSLKPIDVEDAAVMLAYAGKV
VFVPGYGMALSQAQHKLKELADLLEARGVEVKFAIHPVAGRMPGHMNVLLAEAGVDYDK
LKDLEEINPEFPTVDVAVVIGANDVVNPAARRPGSPLYGMPILDVDKAKNVIVIKRGQG
KGFAGVENELFYAENTRMLYGDAQKVLTELIQALKRL
>4o9u_E mol:protein length:384  NAD/NADP transhydrogenase alpha subunit 1
MHHHHHHHHMVTVAVPKERAPGERRVALVPEVVARLVKGGARVRVERGAGEGAYHPDEA
YQEAGAEVVERGELLKGAHLLFTVQPPPEDLIQALEPGAIVVGFVQPHKNLELVRALQA
KKATVIAMELIPRITRAQSMDALSSQATVAGYLAAIHAARLSPRFFPMLTTAAGTIRPA
KVMVMGVGVAGLMAIATAKRLGAQVFAYDVRKAALEQALSLGAKPIELPISAEGEGGYA
RELTEEEKRIQHEALRDHVAGMDVLITTAQVPGRRAPILLTEDMVERLKPGTVVVDLAA
ESGGNCVLTKPGEVVEVRGVRVYGPLNLPSELSVHASEMYAKNLYNLSSLLIEKGAFAP
KWEDEIVRAALLMKEGEVLHGPTKALLGGA
>4o9u_C mol:protein length:100  NAD(P) transhydrogenase subunit alpha 2
MEFGFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVVVVGAMVVLGHAETG
LEKLIGFLGVILGAANAAGGYAVTVRMLEMFERKPGQGGGR
>4o9u_F mol:protein length:384  NAD/NADP transhydrogenase alpha subunit 1
MHHHHHHHHMVTVAVPKERAPGERRVALVPEVVARLVKGGARVRVERGAGEGAYHPDEA
YQEAGAEVVERGELLKGAHLLFTVQPPPEDLIQALEPGAIVVGFVQPHKNLELVRALQA
KKATVIAMELIPRITRAQSMDALSSQATVAGYLAAIHAARLSPRFFPMLTTAAGTIRPA
KVMVMGVGVAGLMAIATAKRLGAQVFAYDVRKAALEQALSLGAKPIELPISAEGEGGYA
RELTEEEKRIQHEALRDHVAGMDVLITTAQVPGRRAPILLTEDMVERLKPGTVVVDLAA
ESGGNCVLTKPGEVVEVRGVRVYGPLNLPSELSVHASEMYAKNLYNLSSLLIEKGAFAP
KWEDEIVRAALLMKEGEVLHGPTKALLGGA