>4o9u_A mol:protein length:100  NAD(P) transhydrogenase subunit alpha 2
MEFGFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVVVVGAMVVLGHAETG
LEKLIGFLGVILGAANAAGGYAVTVRMLEMFERKPGQGGGR