>4o9u_B mol:protein length:450  NAD(P) transhydrogenase subunit beta
MDLIQAAYFVVAILFIVGLKRMAHPTTAKSGIVWAGWGMVLAVLATFFWPGMGNFALIL
LALLLGSVVAWWAAVRVAMTDMPQMVAIYNGMGGGAAATIAAVELLKGAFENTGLMALA
ILGGLIGSVAFTGSLIAFAKLQGIMKSRPILFPGQKAVNALVLALTVVIGLSLLWNDAT
ASIVLFFLLALLFGVLMTLPIGGGDMPVAISFYNAFTGMAVGFEGFAVGNPALMVAGTL
VGAAGTLLTVLMARAMNRSVWSVLVGGFGVEQEAGEVKGSLKPIDVEDAAVMLAYAGKV
VFVPGYGMALSQAQHKLKELADLLEARGVEVKFAIHPVAGRMPGHMNVLLAEAGVDYDK
LKDLEEINPEFPTVDVAVVIGANDVVNPAARRPGSPLYGMPILDVDKAKNVIVIKRGQG
KGFAGVENELFYAENTRMLYGDAQKVLTELIQALKRL