>4oqb_D mol:protein length:267  Poly [ADP-ribose] polymerase 1
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWK
VGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKDIKRKGDEVDGVDEVAKKKSK
KEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVA
DGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREIS
YLKKLKVKKQDRIFPPETSASVALEHHHHHH