>4pjo_B mol:protein length:95  Small nuclear ribonucleoprotein-associated proteins B and B'
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQA
EREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARV