>4pjo_Q mol:protein length:91  Small nuclear ribonucleoprotein Sm D1
GSGSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPV
QLETLSIRGNNIRYFILPDSLPLDTLLVDVEP