>4pjo_k mol:protein length:60  U1 small nuclear ribonucleoprotein 70 kDa
GTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTR
A