>4pjo_q mol:protein length:91  Small nuclear ribonucleoprotein Sm D1
GSGSGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPV
QLETLSIRGNNIRYFILPDSLPLDTLLVDVEP