>4pjo_s mol:protein length:92  Small nuclear ribonucleoprotein E
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLD
DAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN