>4pjw_B mol:protein length:140  Double-strand-break repair protein rad21 homolog
VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRA
QLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVP
EDLRKRRKGGEADNLDEFLKEF