>4q96_E mol:protein length:135  Regulation of nuclear pre-mRNA domain-containing protein 1B
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTF
LYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYG
GEFIQQLKLSMEDSKSP
>4q96_C mol:protein length:21  RPB1-CTD
XSPSYSPTSPSYSPTSPSYSX
>4q96_D mol:protein length:135  Regulation of nuclear pre-mRNA domain-containing protein 1B
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTF
LYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYG
GEFIQQLKLSMEDSKSP
>4q96_F mol:protein length:21  RPB1-CTD
XSPSYSPTSPSYSPTSPSYSX
>4q96_F mol:protein length:21  RPB1-CTD
XSPSYSPTSPSYSPTSPSYSX
>4q96_A mol:protein length:135  Regulation of nuclear pre-mRNA domain-containing protein 1B
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTF
LYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYG
GEFIQQLKLSMEDSKSP
>4q96_B mol:protein length:135  Regulation of nuclear pre-mRNA domain-containing protein 1B
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTF
LYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYG
GEFIQQLKLSMEDSKSP