>4q96_A mol:protein length:135  Regulation of nuclear pre-mRNA domain-containing protein 1B
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTF
LYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYG
GEFIQQLKLSMEDSKSP