>4qkb_B mol:protein length:200  Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial
MWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAIHGFR
ETEKSRWSEASMAIMRRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIA
GLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRI
PRGRRISVICRSLPEGMGPGESG