>4qlc_U mol:protein length:77  H5
SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGV
LKQTKGVGASGSFRLAKS