>4qnr_A mol:protein length:265  Psp operon transcriptional activator
MAEYKDNLLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGP
FISLNCAALNENLLDSELFGHEAGAFTGAQKRHPGRFERADGGTLFLDQLATAPMMVQE
KLLRVIEYGELERVGGSQPLQVNVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLP
PLRERESDIMLMAEYFAIQMCREIKLPLFPGFTERARETLLNYRWPGNIRELKNVVERS
VYRHGTSDYPLDDIIIDPFKRRPPEDAIA
>4qnr_A mol:protein length:265  Psp operon transcriptional activator
MAEYKDNLLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGP
FISLNCAALNENLLDSELFGHEAGAFTGAQKRHPGRFERADGGTLFLDQLATAPMMVQE
KLLRVIEYGELERVGGSQPLQVNVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLP
PLRERESDIMLMAEYFAIQMCREIKLPLFPGFTERARETLLNYRWPGNIRELKNVVERS
VYRHGTSDYPLDDIIIDPFKRRPPEDAIA