>4qum_B mol:protein length:9  Mitogen-activated protein kinase 12
MTGYVVTRR
>4qum_A mol:protein length:306  Tyrosine-protein phosphatase non-receptor type 3
MHHHHHHSSGVDLGTENLYFQSNADTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAI
TFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPL
PHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCT
IAYVSREMLVTNTQTGEEHTVTHLQYVAWPAHGVPDDSSDFLEFVNYVRSLRVDSEPVL
VHSSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAI
LRVYEEGLVQM
>4qum_B mol:protein length:9  Mitogen-activated protein kinase 12
MTGYVVTRR