>4r4n_I mol:protein length:352  HIV-1 gp120
IWKDANTTLFCASDAKAYDTEVHNVWATHACVPTDPSPQELKMENVTEEFNMWKNNMVE
QMHTDIISLWDQSLKPCVQLTGGSALTQACPKVTFEPIPIHYCAPAGYAILKCNDKEFN
GTGLCKNVSTVQCTHGIRPVVSTQLLLNGSLAEGKVMIRSENITNNVKNIIVQLNESVT
INCTRPNNGGSGSGGDIRQAHCNVSGSQWNKTLHQVVEQLRKYWNNNTIIFNSSSGGDL
EITTHSFNCGGEFFYCNTSGLFNSTWVNGTASIENGTITLPCRIKQIINMWQRVGQAIY
APPIQGVIRCVSNITGLILTRDGGGNSNENETFRPGGGDMRDNWRSELYKYKVVKIE