>4rbo_C mol:na length:12  5'-D(*CP*TP*TP*GP*AP*AP*TP*GP*GP*GP*CP*C)-3'
CTTGAATGGGCC
>4rbo_A mol:protein length:70  Putative homeobox protein NANOGP8
GKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSK
RWQKNNWPKNS
>4rbo_E mol:na length:12  5'-D(*GP*GP*CP*CP*CP*AP*TP*TP*CP*AP*AP*G)-3'
GGCCCATTCAAG
>4rbo_B mol:na length:12  5'-D(*GP*GP*CP*CP*CP*AP*TP*TP*CP*AP*AP*G)-3'
GGCCCATTCAAG
>4rbo_F mol:na length:12  5'-D(*CP*TP*TP*GP*AP*AP*TP*GP*GP*GP*CP*C)-3'
CTTGAATGGGCC
>4rbo_D mol:protein length:70  Putative homeobox protein NANOGP8
GKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSK
RWQKNNWPKNS
>4rbo_F mol:na length:12  5'-D(*CP*TP*TP*GP*AP*AP*TP*GP*GP*GP*CP*C)-3'
CTTGAATGGGCC