>4rbo_A mol:protein length:70  Putative homeobox protein NANOGP8
GKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSK
RWQKNNWPKNS