>4rbo_D mol:protein length:70  Putative homeobox protein NANOGP8
GKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSK
RWQKNNWPKNS