>4rdu_E mol:na length:14  (DC)(DG)(DA)(DC)(DT)(DA)(DA)(DT)(DT)(DA)(DG)(DT)(DC)(DG)
CGACTAATTAGTCG
>4rdu_B mol:na length:14  (DC)(DG)(DA)(DC)(DT)(DA)(DA)(DT)(DT)(DA)(DG)(DT)(DC)(DG)
CGACTAATTAGTCG
>4rdu_A mol:protein length:65  Homeobox protein DLX-5
GHMVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKI
KKIMKN
>4rdu_C mol:na length:14  (DC)(DG)(DA)(DC)(DT)(DA)(DA)(DT)(DT)(DA)(DG)(DT)(DC)(DG)
CGACTAATTAGTCG
>4rdu_F mol:na length:14  (DC)(DG)(DA)(DC)(DT)(DA)(DA)(DT)(DT)(DA)(DG)(DT)(DC)(DG)
CGACTAATTAGTCG
>4rdu_F mol:na length:14  (DC)(DG)(DA)(DC)(DT)(DA)(DA)(DT)(DT)(DA)(DG)(DT)(DC)(DG)
CGACTAATTAGTCG
>4rdu_D mol:protein length:65  Homeobox protein DLX-5
GHMVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKI
KKIMKN