>4rdu_A mol:protein length:65  Homeobox protein DLX-5
GHMVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKI
KKIMKN