>4rdu_D mol:protein length:65  Homeobox protein DLX-5
GHMVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKI
KKIMKN